| Species : |
Bovine |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
104 |
| Description : |
CXCL9 is a T-cell chemoattractant induced by IFN-γ belonging to the CXC chemokine family and it is also known as Monokine induced by gamma interferon (MIG). CXCL9 is closely related to two other CXC chemokines called CXCL10 and CXCL11 and they all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 is a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response and chemotactic for activated T-cells. Recombinant bovine CXCL9 contains 104 amino acids which is a single non-glycosylated polypeptide chain. The bovine CXCL9 shares 92 % and 72 % a.a. sequence identity with sheep and human CXCL9. |
| Form : |
Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.0, 500 mM NaCl. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 0.1-1.0 ng/ml. |
| Molecular Mass : |
Approximately 11.9 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids. But it migrates with an apparent molecular mass of 18 kDa in SDS-PAGE. |
| AA Sequence : |
VPAIRNGRCSCINTSQGMIHPKSLKDLKQFAPSPSCEKTEIIATMKNGNEACLNPDLPEVKELIKEWEKQVNQKKKQRKGKKYKKTKKVPKVKRSQRPSQKKTT |
| Endotoxin : |
Less than 0.1 EU/μg of rBoMIG/CXCL9 as determined by LAL method. |
| Purity : |
>96% by SDS-PAGE and HPLC analyses. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20centigrade. Further dilutions should be made in appropriate buffered solutions. |
