Recombinant Bovine CCL20 Protein (27-96 aa), His-SUMO-tagged
Cat.No. : | CCL20-1082B |
Product Overview : | Recombinant Bovine CCL20 Protein (27-96 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 27-96 aa |
Description : | Chotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 24.1 kDa |
AA Sequence : | ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CCL20 C-C motif chemokine ligand 20 [ Bos taurus (cattle) ] |
Official Symbol | CCL20 |
Gene ID | 281666 |
mRNA Refseq | NM_174263 |
Protein Refseq | NP_776688 |
UniProt ID | Q8SQB1 |
◆ Recombinant Proteins | ||
CCL20-717H | Recombinant Human CCL20 protein, His & GST-tagged | +Inquiry |
CCL20-50M | Recombinant Mouse CCL20 protein | +Inquiry |
CCL20-517H | Active Recombinant Human CCL20 Protein, HIgG1 Fc-tagged | +Inquiry |
CCL20-47H | Recombinant Human CCL20 Protein | +Inquiry |
CCL20-2729H | Recombinant Human CCL20 Protein (Ser27-Met96), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL20-447MCL | Recombinant Mouse CCL20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL20 Products
Required fields are marked with *
My Review for All CCL20 Products
Required fields are marked with *
0
Inquiry Basket