Recombinant Borrelia ospA therapeutic protein(Lyme disease vaccine (recombinant OspA))
| Cat.No. : | ospA-P045H |
| Product Overview : | Vaccine against Lyme disease that contains lipoprotein OspA, an outer surface protein of Borrelia burgdorferi, as expressed by Escherichia coli. Lipoprotein OspA is a single polypeptide chain of 257 amino acids with lipids covalently bonded to the N terminus. It is conjugated with alum (aluminum hydroxide) as an adjuvant. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Borrelia |
| Source : | E.coli |
| Tag : | Non |
| ProteinLength : | 257aa |
| Description : | Our expression product is the active ingredient of LYMErix. |
| Molecular Mass : | 27.7 Kda |
| AA Sequence : | MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDVPGGMKVLVSKEKNKDGKYDLMATVDNVDLKGTSDKNN GSGILEGVKADKSKVKLTVADDLSKTTLEVLKEDGTVVSRKVTSKDKSTTEAKFNEKGELSEKTMTRANGT TLEYSQMTNEDNAAKAVETLKNGIKFEGNLASGKTAVEIKEGTVTLKREIDKNGKVTVSLNDTASGSKKTA SWQESTSTLTISANSKKTKDLVFLTNGTITVQNYDSAGTKLEGSAAEIKKLDELKNALR |
| Purity : | >95% |
| ◆ Native Proteins | ||
| IgG-346D | Native Dog Gamma Globulin Fraction | +Inquiry |
| LAMA-69M | Native Mouse Laminin protein | +Inquiry |
| NUC-0003 | Native Human Nucleosome | +Inquiry |
| HP-192F | Native Feline Haptoglobin | +Inquiry |
| Lectin-1795A | Active Native Artocarpus integrifolia Jacalin Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AVPI1-8558HCL | Recombinant Human AVPI1 293 Cell Lysate | +Inquiry |
| LOC650128-899HCL | Recombinant Human LOC650128 cell lysate | +Inquiry |
| C6orf141-122HCL | Recombinant Human C6orf141 lysate | +Inquiry |
| BTNL3-194HCL | Recombinant Human BTNL3 cell lysate | +Inquiry |
| PIGX-3194HCL | Recombinant Human PIGX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ospA Products
Required fields are marked with *
My Review for All ospA Products
Required fields are marked with *
0
Inquiry Basket
