Recombinant BCoV(strain F15) N protein(1-448aa), His-tagged
Cat.No. : | N-7864B |
Product Overview : | Recombinant BCoV(strain F15) N protein(P19902)(1-448aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BtCoV |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-448aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSFTPGKQSSSRASSGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTRDGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIVSLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI |
◆ Cell & Tissue Lysates | ||
NP-001SCL | Recombinant SARS NP cell lysate | +Inquiry |
NP-003HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
NP-002HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
NP-004HCL | Recombinant H5N1 NP cell lysate | +Inquiry |
NP-005HCL | Recombinant H7N9 NP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NP Products
Required fields are marked with *
My Review for All NP Products
Required fields are marked with *
0
Inquiry Basket