Recombinant Bartonella Henselae LIPA Protein (1-320 aa), His-tagged

• Cat.No.: LIPA-2402B
• Product Overview: Recombinant Bartonella Henselae (strain ATCC 49882/DSM 28221/Houston 1) (Rochalimaea henselae) LIPA Protein (1-320 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Description: Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.
• Source: Yeast
• Species: Bartonella Henselae
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 38.7 kDa
• Protein length: 1-320 aa
• AA Sequence: MVTVVDRVTDRRLRHPEKAHRPDTSVQKKPDWIRVKAPTSQVYKETHGIVRAHKLVTVCEEAGCPNIGECWSQRHASFMILGEICTRACAFCNVATGIPFAVDENEPERVADAVARMELKHVVITSVDRDDLADGGAEHFAKVIYAIRRKAPKTTIEVLTPDFRHKDGALEIVVAAKPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVPPEEFESFAKIGKVKGFLHMASNPLTRSSHHAGDDFAILQKARDEKFALQR
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: lipA
• UniProt ID: Q6G401