Recombinant Artificial EGFP (Full Length), His-tagged, Biotinylated

• Cat.No.: EGFP-17
• Product Overview: Recombinant Biotinylated Artificial sequence Enhanced Green Fluorescent protein with a His tag was expressed in HEK293.

Specification

• Source: HEK293
• Tag: His
• Form: Lyophilized powder
• Molecular Mass: Recombinant protein has a calculated molecular weight of about 30 kDa.
• AA Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
• Endotoxin: Not determined
• Purity: >95%
• Applications: Functional Assay, Protein-protein Interaction, Post-translational Modifications, ELISA, EIA, Western Blotting, Dot Blotting, Immunoprecipitation, Protein Array, etc.
• Notes: This product is furnished for LABORATORY RESEARCH USE ONLY. Not for diagnostic or therapeutic use.
• Storage: Upon arrival, the lyophilized protein may be stored for 2 weeks at 4 centigrade. For long term storage, it is recommended to store desiccated below -20 centigrade in a manual defrost freezer. Following reconstitution, the protein may be stored for 2 weeks under sterile conditions at -20 centigrade. For long term storage, it is recommended to make appropriate aliquots and store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered solution in PBS
• Reconstitution: Briefly spin the vial and bring the contents to the bottom prior to opening. It is recommended to reconstitute at 0.5-1 mg/mL with sterile deionized water.
• Shipping: Ice packs

Gene Information

• Official Symbol: EGFP
• Synonyms: Enhanced green fluorescent protein; EGFP