Recombinant Active Pig CSF2 Protein, His-tagged(N-ter)

• Cat.No.: CSF2-50P
• Product Overview: Recombinant Active Pig CSF2 Protein with His tag (N-ter) was expressed in E. coli.

Specification

• Species: Pig
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 3 ng/mL.
• AA Sequence: APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Sus scrofa ]
• Official Symbol: CSF2
• Synonyms: CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; colony-stimulating factor; GM-CSF
• Gene ID: 397208
• mRNA Refseq: NM_214118
• Protein Refseq: NP_999283