Recombinant Active Mouse IL9 Protein, His-tagged(N-ter)
Cat.No. : | Il9-219M |
Product Overview : | Recombinant Active Mouse IL9 Protein with His tag (N-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce proliferation in MO7e cells. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 10^6 IU/mg. |
AA Sequence : | QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il9 interleukin 9 [ Mus musculus ] |
Official Symbol | Il9 |
Synonyms | IL9; interleukin 9; interleukin-9; cytokine P40; T-cell growth factor P40; P40; Il-9; |
Gene ID | 16198 |
mRNA Refseq | NM_008373 |
Protein Refseq | NP_032399 |
◆ Recombinant Proteins | ||
IL9-668H | Recombinant Human IL9 protein, His & T7-tagged | +Inquiry |
Il9-477M | Active Recombinant Mouse Interleukin 9 | +Inquiry |
Il9-63M | Active Recombinant Mouse Il9 Protein (Gln19-Pro144), N-His tagged, Animal-free, Carrier-free | +Inquiry |
IL9-858M | Active Recombinant Mouse IL9 Protein (Met1-Pro144), His-tagged | +Inquiry |
IL9-28162TH | Recombinant Human IL9, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL9 Products
Required fields are marked with *
My Review for All IL9 Products
Required fields are marked with *
0
Inquiry Basket