Recombinant Active Mouse IL4 Protein, His-tagged(C-ter)

• Cat.No.: Il4-204M
• Product Overview: Recombinant Active Mouse IL4 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to induce HT-2 cells proliferation. The ED50 for this effect is < 1 ng/mL. The specific activity of recombinant mouse IL-4 is approximately > 1 x 10^6 IU/mg.
• AA Sequence: MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: Il4 interleukin 4 [ Mus musculus ]
• Official Symbol: Il4
• Synonyms: IL4; interleukin 4; interleukin-4; IGG1 induction factor; B-cell growth factor 1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; B-cell IgG differentiation factor; Il-4; BSF-1
• Gene ID: 16189
• mRNA Refseq: NM_021283
• Protein Refseq: NP_067258