Recombinant Active Mouse IL36A Protein, His-tagged(C-ter)

• Cat.No.: Il36a-196M
• Product Overview: Recombinant Active Mouse IL36A Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Description: Enables cytokine activity. Acts upstream of or within positive regulation of interleukin-6 production. Located in extracellular space. Orthologous to human IL36A (interleukin 36 alpha).
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Powder
• Bio-activity: Determined by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is > 1 x 10^5 IU/mg.
• AA Sequence: MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: Il36a interleukin 36A [ Mus musculus (house mouse) ]
• Official Symbol: Il36a
• Synonyms: Il36a; interleukin 36A; Fil1; If36a; Il1f6; Il1f9; IL-1H1; IL1RP2
• Gene ID: 54448
• mRNA Refseq: NM_019450
• Protein Refseq: NP_062323
• UniProt ID: Q9JLA2