Recombinant Active Mouse IL36A Protein, His-tagged(C-ter)
Cat.No. : | Il36a-196M |
Product Overview : | Recombinant Active Mouse IL36A Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Enables cytokine activity. Acts upstream of or within positive regulation of interleukin-6 production. Located in extracellular space. Orthologous to human IL36A (interleukin 36 alpha). |
Form : | Powder |
Bio-activity : | Determined by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is > 1 x 10^5 IU/mg. |
AA Sequence : | MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il36a interleukin 36A [ Mus musculus (house mouse) ] |
Official Symbol | Il36a |
Synonyms | Il36a; interleukin 36A; Fil1; If36a; Il1f6; Il1f9; IL-1H1; IL1RP2; |
Gene ID | 54448 |
mRNA Refseq | NM_019450 |
Protein Refseq | NP_062323 |
UniProt ID | Q9JLA2 |
◆ Recombinant Proteins | ||
IL1F6-398H | Active Recombinant Human Interleukin 1 Family, Member 6 (Epsilon) | +Inquiry |
Il36a-3506M | Recombinant Mouse Il36a Protein, Myc/DDK-tagged | +Inquiry |
IL36A-151H | Recombinant Human IL36A Protein, His-tagged | +Inquiry |
IL36A-2578H | Recombinant Human IL36A protein, His-tagged | +Inquiry |
IL36A-507H | Active Recombinant Human IL36A protein(Ala6-Phe158) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36A-5238HCL | Recombinant Human IL1F6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL36A Products
Required fields are marked with *
My Review for All IL36A Products
Required fields are marked with *
0
Inquiry Basket