Recombinant Active Mouse IL36A Protein, His-tagged(C-ter)

Cat.No. : Il36a-196M
Product Overview : Recombinant Active Mouse IL36A Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Enables cytokine activity. Acts upstream of or within positive regulation of interleukin-6 production. Located in extracellular space. Orthologous to human IL36A (interleukin 36 alpha).
Form : Powder
Bio-activity : Determined by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is > 1 x 10^5 IU/mg.
AA Sequence : MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name Il36a interleukin 36A [ Mus musculus (house mouse) ]
Official Symbol Il36a
Synonyms Il36a; interleukin 36A; Fil1; If36a; Il1f6; Il1f9; IL-1H1; IL1RP2;
Gene ID 54448
mRNA Refseq NM_019450
Protein Refseq NP_062323
UniProt ID Q9JLA2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL36A Products

Required fields are marked with *

My Review for All IL36A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon