Recombinant Active Mouse IL15 Protein, His-tagged(N-ter)
Cat.No. : | Il15-146M |
Product Overview : | Recombinant Active Mouse IL15 Protein with His tag (N-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported. [provided by RefSeq, Feb 2011] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce CTLL-2 cells proliferation. The ED50 for this effect is < 10 ng/mL. The specific activity of recombinant mouse IL-15 is approximately > 1x 10^5 IU/mg. |
AA Sequence : | NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il15 interleukin 15 [ Mus musculus ] |
Official Symbol | Il15 |
Synonyms | IL15; interleukin 15; interleukin-15; IL-15; AI503618; |
Gene ID | 16168 |
mRNA Refseq | NM_001254747 |
Protein Refseq | NP_001241676 |
◆ Recombinant Proteins | ||
Il15-533M | Active Recombinant Mouse Interleukin 15, His-tagged | +Inquiry |
IL15-2683R | Recombinant Rat IL15 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL15-063H | Active Recombinant Human IL15 Protein | +Inquiry |
Il15-784G | Recombinant Golden hamster Il15 protein, His&Strep II-tagged | +Inquiry |
IL15-180H | Active Recombinant Human IL15 Protein (Asn49-Ser162), N-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL15-5248HCL | Recombinant Human IL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL15 Products
Required fields are marked with *
My Review for All IL15 Products
Required fields are marked with *
0
Inquiry Basket