Recombinant Active Mouse CXCL12 Protein, His-tagged(C-ter)

Cat.No. : Cxcl12-55M
Product Overview : Recombinant Active Mouse CXCL12 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
Form : Powder
Bio-activity : Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CXCR4. The ED50 for this effect is < 0.5 ng/mL.
AA Sequence : MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name Cxcl12 chemokine (C-X-C motif) ligand 12 [ Mus musculus ]
Official Symbol Cxcl12
Synonyms CXCL12; chemokine (C-X-C motif) ligand 12; stromal cell-derived factor 1; C-X-C motif chemokine 12; pre-B cell growth-stimulating factor; pre-B-cell growth-stimulating factor; thymic lymphoma cell-stimulating factor; 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; Pbsf; Sdf1; Tlsf; Sdf1a; Sdf1b; Tlsfa; Tlsfb; Tpar1; Scyb12; AI174028;
Gene ID 20315
mRNA Refseq NM_001012477
Protein Refseq NP_001012495

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXCL12 Products

Required fields are marked with *

My Review for All CXCL12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon