Recombinant Active Human EPCAM Protein, His-tagged(C-ter)
Cat.No. : | EPCAM-66H |
Product Overview : | Recombinant Active Human EPCAM Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008] |
Form : | Powder |
Bio-activity : | Determined by the ability of the immobilized protein to support the adhesion of the 3T3 cells. The ED50 for this effect is 0.2-1.7 ng/mL. |
AA Sequence : | MQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | EPCAM epithelial cell adhesion molecule [ Homo sapiens ] |
Official Symbol | EPCAM |
Synonyms | EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH99; MK 1; MOC31; TACST 1; TROP1; epithelial glycoprotein 314; human epithelial glycoprotein-2; cell surface glycoprotein Trop-1; adenocarcinoma-associated antigen; tumor-associated calcium signal transducer 1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); M4S1; MK-1; DIAR5; EGP-2; MIC18; EGP314; HNPCC8; TACSTD1; GA733-2; |
Gene ID | 4072 |
mRNA Refseq | NM_002354 |
Protein Refseq | NP_002345 |
MIM | 185535 |
UniProt ID | P16422 |
◆ Recombinant Proteins | ||
EPCAM-3152H | Recombinant Human EPCAM Protein (Gln24-Lys265), His tagged | +Inquiry |
EPCAM-1821C | Recombinant Cynomolgus EPCAM protein, His-tagged | +Inquiry |
EPCAM-475HP | Recombinant Human EPCAM protein, Fc-tagged, R-PE labeled | +Inquiry |
Epcam-7481RAF555 | Recombinant Rat Epcam Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Epcam-7481RF | Recombinant Rat Epcam Protein, Fc-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPCAM Products
Required fields are marked with *
My Review for All EPCAM Products
Required fields are marked with *
0
Inquiry Basket