Recombinant Acinetobacter calcoaceticus pfeA Protein
| Cat.No. : | pfeA-150A |
| Product Overview : | Recombinant Acinetobacter calcoaceticus pfeA Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Acinetobacter calcoaceticus |
| Source : | E.coli |
| Description : | Ferric enterobactin receptor precursor |
| Form : | 50mM Tris-HCl, pH 8.0, 200mM NaCl. |
| Molecular Mass : | ～19 kDa |
| AA Sequence : | QSLGVSVITKEDLEKLPVRNDISDYVRRMPGVNLTGNSATGQRGNNRQIDIRGMGPENTLILVDGKPINSRNSVRYGWKGERDTRGDSNWVPAEAIESIEVLRGPAAARYGSGAAGGVVN |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Gene Name | pfeA ferric enterobactin receptor precursor [ Acinetobacter pittii PHEA-2 ] |
| Official Symbol | pfeA |
| Gene ID | 11638437 |
| Protein Refseq | YP_004994529 |
| UniProt ID | F0KGT9 |
| ◆ Native Proteins | ||
| Lectin-1864W | Active Native Succinylated Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
| Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
| KLKB1-211S | Active Native Porcine Kallikrein | +Inquiry |
| 293T-01NE | Native HEK293 Nuclear Extract | +Inquiry |
| PLG-27842TH | Native Human PLG | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NEUROD1-3868HCL | Recombinant Human NEUROD1 293 Cell Lysate | +Inquiry |
| VAT1-425HCL | Recombinant Human VAT1 293 Cell Lysate | +Inquiry |
| TSSK2-693HCL | Recombinant Human TSSK2 293 Cell Lysate | +Inquiry |
| ATAD1-44HCL | Recombinant Human ATAD1 lysate | +Inquiry |
| AMBP-001HCL | Recombinant Human AMBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pfeA Products
Required fields are marked with *
My Review for All pfeA Products
Required fields are marked with *
0
Inquiry Basket
