GMP Recombinant Porcine CXCL9 Protein, His-Tagged

• Cat.No.: CXCL9-01P
• Product Overview: GMP Recombinant Porcine CXCL9 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Porcine
• Source: E.coli
• Tag: His
• Description: CXCL9, also named Monokine, is a member of the CXC chemokine family and is induced by gamma interferon (MIG). Following induced by IFN-gamma, this chemokine can attract T-cells . CXCL9 has close relationship with two other CXC chemokines named CXCL10 and CXCL11, additionally they all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 is also a cytokine that affects the growth, movement, or activation state of cells participating in immune and inflammatory response and work as a chemoattractant of activated T-cells.
• Form: Lyophilized
• AA Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: CXCL9 C-X-C motif chemokine ligand 9 [ Sus scrofa (pig) ]
• Official Symbol: CXCL9
• Synonyms: MIG
• Gene ID: 100135681
• mRNA Refseq: NM_001114289.2
• Protein Refseq: NP_001107761.2
• UniProt ID: A0A4X1SX95