Description :	This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5 untranslated region have been found for this gene.
Protein length :	52 amino acids
Molecular Weight :	31.350kDa inclusive of tags
Biological activity :	Useful for Antibody Production and Protein Array
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA
Sequence Similarities :	Belongs to the claudin family.

Gene Name	CLDN2 claudin 2 [ Homo sapiens ]
Official Symbol	CLDN2
Synonyms	CLDN2; claudin 2; claudin-2;
Gene ID	9075
mRNA Refseq	NM_001171092
Protein Refseq	NP_001164563
MIM	300520
Uniprot ID	P57739
Chromosome Location	Xq22.3-q23
Pathway	Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function	identical protein binding; structural molecule activity;