Recombinant Human CHMP2B
Cat.No. : | CHMP2B-27996TH |
Product Overview : | Recombinant full length protein corresponding to amino acids 1-213 of Human CHMP2B with a propreitary tag; predicted mwt: 49.06 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 213 amino acids |
Description : | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. |
Molecular Weight : | 49.060kDa inclusive of tags |
Tissue specificity : | Widely expressed. Expressed in brain, heart, skeletal muscle, spleen, kidney, liver, small intestine, pancreas, lung, placenta and leukocytes. In brain, it is expressed in cerebellum, cerebral cortex, medulla, spinal chord, occipital lobe, frontal lobe, t |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
Sequence Similarities : | Belongs to the SNF7 family. |
Gene Name | CHMP2B charged multivesicular body protein 2B [ Homo sapiens ] |
Official Symbol | CHMP2B |
Synonyms | CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B; |
Gene ID | 25978 |
mRNA Refseq | NM_001244644 |
Protein Refseq | NP_001231573 |
Uniprot ID | Q9UQN3 |
Chromosome Location | 3p12.1 |
Pathway | ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
Function | protein domain specific binding; |
◆ Recombinant Proteins | ||
CHMP2B-11185H | Recombinant Human CHMP2B, His-tagged | +Inquiry |
CHMP2B-79HF | Recombinant Full Length Human CHMP2B Protein | +Inquiry |
Chmp2b-2147M | Recombinant Mouse Chmp2b Protein, Myc/DDK-tagged | +Inquiry |
CHMP2B-27996TH | Recombinant Human CHMP2B | +Inquiry |
CHMP2B-5021H | Recombinant Human CHMP2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP2B-185HCL | Recombinant Human CHMP2B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHMP2B Products
Required fields are marked with *
My Review for All CHMP2B Products
Required fields are marked with *
0
Inquiry Basket