Recombinant Human CFHR1 protein, GST-tagged
Cat.No. : | CFHR1-27138TH |
Product Overview : | Recombinant Human CFHR1(19 a.a. - 330 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 19-330 a.a. |
Description : | This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 60.06 kDa |
AA Sequence : | EATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWSPTPKCLRLCFFPFVE NGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPS GERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQL EGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCW DGKLEYPTCAKR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CFHR1 complement factor H-related 1 [ Homo sapiens ] |
Official Symbol | CFHR1 |
Synonyms | CFHR1; complement factor H-related 1; CFHL1, CFHL1P, CFHR1P, complement factor H related 1 pseudogene , H factor (complement) like 1 , H factor (complement) like 2 , HFL1, HFL2; complement factor H-related protein 1; CFHL; FHR1; H36 1; H36 2; H36; FHR-1; H-factor-like 1; h factor-like protein 1; H factor (complement)-like 1; H factor (complement)-like 2; complement factor H-related 1 pseudogene; HFL1; HFL2; CFHL1; H36-1; H36-2; CFHL1P; CFHR1P; MGC104329; |
Gene ID | 3078 |
mRNA Refseq | NM_002113 |
Protein Refseq | NP_002104 |
MIM | 134371 |
UniProt ID | Q03591 |
Chromosome Location | 1q32 |
◆ Recombinant Proteins | ||
CFHR1-8555H | Recombinant Human CFHR1 protein(Met1-Arg330), His-tagged | +Inquiry |
CFHR1-268H | Recombinant Human CFHR1, His-tagged | +Inquiry |
CFHR1-764H | Recombinant Human CFHR1 Protein, His-tagged | +Inquiry |
CFHR1-1000H | Recombinant Human CFHR1 Protein (Glu19-Arg330), C-His tagged | +Inquiry |
CFHR1-269H | Recombinant Human CFHR1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFHR1-1289HCL | Recombinant Human CFHR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFHR1 Products
Required fields are marked with *
My Review for All CFHR1 Products
Required fields are marked with *
0
Inquiry Basket