Recombinant Human BPHL, His-tagged

• Cat.No.: BPHL-27669TH
• Product Overview: Recombinant full length Human BPHL with N terminal His tag; 275 amino acids with tag, MWt 31.1 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 254 amino acids
• Description: This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described.
• Conjugation: HIS
• Molecular Weight: 31.100kDa inclusive of tags
• Tissue specificity: Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
• Sequence Similarities: Belongs to the AB hydrolase superfamily. Lipase family.

Gene Information

• Gene Name: BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ]
• Official Symbol: BPHL
• Synonyms: BPHL; biphenyl hydrolase-like (serine hydrolase); MCNAA; valacyclovir hydrolase; Bph rp; breast epithelial mucin associated antigen
• Gene ID: 670
• mRNA Refseq: NM_004332
• Protein Refseq: NP_004323
• MIM: 603156
• Uniprot ID: Q86WA6
• Chromosome Location: 6p25
• Function: hydrolase activity