Recombinant Human BCAM

• Cat.No.: BCAM-27252TH
• Product Overview: Recombinant fragment of Human CD239 with N terminal proprietary tag; Predicted MW 36.63 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five, N-terminus, extracellular immunoglobulin domains, a single transmembrane domain, and a short, C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Wide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGA
• Sequence Similarities: Contains 3 Ig-like C2-type (immunoglobulin-like) domains.Contains 2 Ig-like V-type (immunoglobulin-like) domains.

Gene Information

• Gene Name: BCAM basal cell adhesion molecule (Lutheran blood group) [ Homo sapiens ]
• Official Symbol: BCAM
• Synonyms: BCAM; basal cell adhesion molecule (Lutheran blood group); basal cell adhesion molecule (Lu and Au blood groups) , LU, Lutheran blood group (Auberger b antigen included); basal cell adhesion molecule; CD239
• Gene ID: 4059
• mRNA Refseq: NM_001013257
• Protein Refseq: NP_001013275
• MIM: 612773
• Uniprot ID: P50895
• Chromosome Location: 19q12-q13
• Function: laminin binding; laminin receptor activity; transmembrane signaling receptor activity