Recombinant Human ACYP1, His-tagged

Cat.No. : ACYP1-26215TH
Product Overview : Recombinant full length Human ACYP1 (amino acids 1-99) with an N terminal His tag; 122aa, 13.6kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 99 amino acids
Description : Acylphosphatase is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis.
Conjugation : HIS
Molecular Weight : 13.600kDa inclusive of tags
Tissue specificity : Organ-common type isozyme is found in many different tissues.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Sequence Similarities : Belongs to the acylphosphatase family.Contains 1 acylphosphatase-like domain.
Gene Name ACYP1 acylphosphatase 1, erythrocyte (common) type [ Homo sapiens ]
Official Symbol ACYP1
Synonyms ACYP1; acylphosphatase 1, erythrocyte (common) type; acylphosphatase-1;
Gene ID 97
mRNA Refseq NM_001107
Protein Refseq NP_001098
MIM 600875
Uniprot ID P07311
Chromosome Location 14q24.3
Pathway Pyruvate metabolism, organism-specific biosystem; Pyruvate metabolism, conserved biosystem;
Function acylphosphatase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACYP1 Products

Required fields are marked with *

My Review for All ACYP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon