Active Recombinant Human CD44, Fc-tagged, Biotinylated
Cat.No. : | CD44-578H |
Product Overview : | The recombinant human CD44-Fc is expressed as a 470 amino acid protein consisting of Gln21 - Thr263 region of CDw44 (UniProt accession #P16070 - isoform 12 or CDw44) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 21-263 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized CD44-Fc protein binds hyaluronan and anti-CD44 monoclonal antibodies, human IgG1, mouse IgG2a and rabbit IgG with high affinity (KD< 1="" nm)="" in="" a="" functional=""> |
Molecular Mass : | Calculated molecular mass (kDa): 52; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 |
AA Sequence : | QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPN SICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDI YPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRDQDTFHPSGGSHTTHGSES DGHSHGSQEGGANTTSGPIRTDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CD44 CD44 molecule (Indian blood group) [ Homo sapiens ] |
Official Symbol | CD44 |
Synonyms | CD44; CD44 molecule (Indian blood group); CD44 antigen (homing function and Indian blood group system) , MDU2, MDU3, MIC4; CD44 antigen; CD44R; chondroitin sulfate proteoglycan 8; CSPG8; HCELL; hematopoietic cell E and L selectin ligand; IN; MC56; Pgp1; epican; Hermes antigen; hyaluronate receptor; phagocytic glycoprotein 1; heparan sulfate proteoglycan; cell surface glycoprotein CD44; extracellular matrix receptor III; GP90 lymphocyte homing/adhesion receptor; hematopoietic cell E- and L-selectin ligand; homing function and Indian blood group system; LHR; MDU2; MDU3; MIC4; CDW44; HUTCH-I; ECMR-III; MGC10468; |
Gene ID | 960 |
mRNA Refseq | NM_000610 |
Protein Refseq | NP_000601 |
MIM | 107269 |
UniProt ID | P16070 |
Chromosome Location | 11p13 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; |
Function | binding; collagen binding; hyaluronic acid binding; hyaluronic acid binding; hyaluronic acid binding; hyalurononglucosaminidase activity; protein binding; receptor activity; contributes_to transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
CD44-2665H | Recombinant Human CD44 protein, His-SUMO-tagged | +Inquiry |
Cd44-624MAF555 | Active Recombinant Mouse Cd44 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD44-891M | Recombinant Mouse CD44 Protein (Met1-Thr224), His-tagged | +Inquiry |
CD44-3095HAF555 | Recombinant Human CD44 Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Cd44-1017RAF647 | Active Recombinant Rat Cd44 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD44-1090HCL | Recombinant Human CD44 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD44 Products
Required fields are marked with *
My Review for All CD44 Products
Required fields are marked with *
0
Inquiry Basket