Active Recombinant Human CD44, Fc-tagged, Biotinylated

Cat.No. : CD44-578H
Product Overview : The recombinant human CD44-Fc is expressed as a 470 amino acid protein consisting of Gln21 - Thr263 region of CDw44 (UniProt accession #P16070 - isoform 12 or CDw44) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 21-263 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized CD44-Fc protein binds hyaluronan and anti-CD44 monoclonal antibodies, human IgG1, mouse IgG2a and rabbit IgG with high affinity (KD< 1="" nm)="" in="" a="" functional="">
Molecular Mass : Calculated molecular mass (kDa): 52; Estimated by SDS-PAGE under reducing condition (kDa): 80-90
AA Sequence : QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPN SICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDI YPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRDQDTFHPSGGSHTTHGSES DGHSHGSQEGGANTTSGPIRTDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name CD44 CD44 molecule (Indian blood group) [ Homo sapiens ]
Official Symbol CD44
Synonyms CD44; CD44 molecule (Indian blood group); CD44 antigen (homing function and Indian blood group system) , MDU2, MDU3, MIC4; CD44 antigen; CD44R; chondroitin sulfate proteoglycan 8; CSPG8; HCELL; hematopoietic cell E and L selectin ligand; IN; MC56; Pgp1; epican; Hermes antigen; hyaluronate receptor; phagocytic glycoprotein 1; heparan sulfate proteoglycan; cell surface glycoprotein CD44; extracellular matrix receptor III; GP90 lymphocyte homing/adhesion receptor; hematopoietic cell E- and L-selectin ligand; homing function and Indian blood group system; LHR; MDU2; MDU3; MIC4; CDW44; HUTCH-I; ECMR-III; MGC10468;
Gene ID 960
mRNA Refseq NM_000610
Protein Refseq NP_000601
MIM 107269
UniProt ID P16070
Chromosome Location 11p13
Pathway Cytokine Signaling in Immune system, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem;
Function binding; collagen binding; hyaluronic acid binding; hyaluronic acid binding; hyaluronic acid binding; hyalurononglucosaminidase activity; protein binding; receptor activity; contributes_to transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD44 Products

Required fields are marked with *

My Review for All CD44 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon