Recombinant Human ARNT, GST-tagged
Cat.No. : | ARNT-20H |
Product Overview : | Recombinant Human ARNT(1 a.a. - 789 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 113 kDa |
AA Sequence : | MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFA RSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTST DGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQL STSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTF VDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPY SDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHS QVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSS FSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPA QQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Publications : |
Hypoxia disrupts aryl hydrocarbon receptor signaling and the Th17 response in allergic rhinitis patients (2018)
|
Gene Name | ARNT aryl hydrocarbon receptor nuclear translocator [ Homo sapiens (human) ] |
Official Symbol | ARNT |
Synonyms | ARNT; aryl hydrocarbon receptor nuclear translocator; bHLHe2; HIF 1beta; dioxin receptor, nuclear translocator; class E basic helix-loop-helix protein 2; hypoxia-inducible factor 1, beta subunit; HIF1B; TANGO; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta |
Gene ID | 405 |
mRNA Refseq | NM_001668 |
Protein Refseq | NP_001659 |
MIM | 126110 |
UniProt ID | P27540 |
Chromosome Location | 1q21 |
Pathway | AhR pathway; Cellular response to hypoxia; Chemical carcinogenesis |
Function | contributes_to RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity; aryl hydrocarbon receptor activity; aryl hydrocarbon receptor binding |
◆ Recombinant Proteins | ||
ARNT-3648H | Recombinant Human ARNT, His-tagged | +Inquiry |
ARNT-19H | Recombinant Human ARNT, MYC/DDK-tagged | +Inquiry |
ARNT-744M | Recombinant Mouse ARNT Protein, His (Fc)-Avi-tagged | +Inquiry |
ARNT-8057H | Recombinant Human ARNT protein, His & T7-tagged | +Inquiry |
RFL-1217HF | Recombinant Full Length Human Aryl Hydrocarbon Receptor Nuclear Translocator(Arnt) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARNT-8692HCL | Recombinant Human ARNT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARNT Products
Required fields are marked with *
My Review for All ARNT Products
Required fields are marked with *
0
Inquiry Basket