Recombinant Human ARNT, GST-tagged

Cat.No. : ARNT-20H
Product Overview : Recombinant Human ARNT(1 a.a. - 789 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants.
Molecular Mass : 113 kDa
AA Sequence : MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFA RSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTST DGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQL STSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTF VDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPY SDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHS QVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSS FSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPA QQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Publications :
Hypoxia disrupts aryl hydrocarbon receptor signaling and the Th17 response in allergic rhinitis patients (2018)
Gene Name ARNT aryl hydrocarbon receptor nuclear translocator [ Homo sapiens (human) ]
Official Symbol ARNT
Synonyms ARNT; aryl hydrocarbon receptor nuclear translocator; bHLHe2; HIF 1beta; dioxin receptor, nuclear translocator; class E basic helix-loop-helix protein 2; hypoxia-inducible factor 1, beta subunit; HIF1B; TANGO; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta
Gene ID 405
mRNA Refseq NM_001668
Protein Refseq NP_001659
MIM 126110
UniProt ID P27540
Chromosome Location 1q21
Pathway AhR pathway; Cellular response to hypoxia; Chemical carcinogenesis
Function contributes_to RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity; aryl hydrocarbon receptor activity; aryl hydrocarbon receptor binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARNT Products

Required fields are marked with *

My Review for All ARNT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon