Recombinant Aeromonas CED40 protein

• Cat.No.: CED40
• Product Overview: Recombinant Aeromonas CED40 protein was expressed in Escherichia coli.

Specification

• Species: Aeromonas
• Source: E.coli
• Tag: Non
• Protein Length: 291
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, 150 mM NaCl, 5μM ZnSO4, pH 8.0.
• Bio-activity: Sequentially cleaves N-terminal amino acids except E, D, and X-P.
• Molecular Mass: Approximately 31.4 kDa, a single non-glycosylated polypeptide chain containing 291 amino acids.
• AA Sequence: MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
• Endotoxin: Less than 0.1 EU/µg of rAeromonas Aminopeptidase as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• UniProt ID: Q01693