Recombinant Human PTPRN
Cat.No. : | PTPRN-01H |
Product Overview : | Recombinant Human PTPRN protein, a DNA sequence encoding the amino acid (605-979) was expressed in E. coli and purified by Affinity chromatography, RT-HPLC. |
Availability | April 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 605-979 a.a. |
Description : | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. Alternate splicing results in multiple transcript variants. |
Form : | 1×PBS |
Molecular Mass : | 42.3kDa |
AA Sequence : | RQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSW CEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIK LKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPD EGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRG RSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILK ALPQ |
Endotoxin : | <1.0eu g="" purified="" protein="" (lal="">1.0eu> |
Purity : | >99% as determined by RT-HPLC |
Storage : | Can be stored at +4℃ short term (1-2 weeks). For long term storage, store at -20℃ or -70℃ |
Gene Name | PTPRN protein tyrosine phosphatase, receptor type, N [ Homo sapiens ] |
Official Symbol | PTPRN |
Synonyms | PTPRN; protein tyrosine phosphatase, receptor type, N; receptor-type tyrosine-protein phosphatase-like N; IA 2; ICA 512; PTP IA-2; islet cell antigen 2; islet cell antigen 512; islet cell autoantigen 3; protein tyrosine phosphatase-like N; IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; FLJ16131; |
Gene ID | 5798 |
mRNA Refseq | NM_001199763 |
Protein Refseq | NP_001186692 |
MIM | 601773 |
UniProt ID | Q16849 |
Chromosome Location | 2q35-q36.1 |
Pathway | Type I diabetes mellitus, organism-specific biosystem; Type I diabetes mellitus, conserved biosystem; |
Function | GTPase binding; hydrolase activity; phosphatase activity; protein binding; protein tyrosine phosphatase activity; receptor activity; transmembrane receptor protein tyrosine phosphatase activity; |
◆ Recombinant Proteins | ||
PTPRN-4841R | Recombinant Rat PTPRN Protein | +Inquiry |
PTPRN-678H | Recombinant Human PTPRN Protein, His-tagged | +Inquiry |
PTPRN-01H | Recombinant Human PTPRN | +Inquiry |
PTPRN-4500R | Recombinant Rat PTPRN Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPRN-675H | Recombinant Human PTPRN Protein, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRN-1440HCL | Recombinant Human PTPRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTPRN Products
Required fields are marked with *
My Review for All PTPRN Products
Required fields are marked with *
0
Inquiry Basket