Recombinant Human PTPRN

• Cat.No.: PTPRN-01H
• Product Overview: Recombinant Human PTPRN protein, a DNA sequence encoding the amino acid (605-979) was expressed in E. coli and purified by Affinity chromatography, RT-HPLC.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 605-979 a.a.
• Description: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. Alternate splicing results in multiple transcript variants.
• Form: 1×PBS
• Molecular Mass: 42.3kDa
• AA Sequence: RQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSW CEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIK LKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPD EGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRG RSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILK ALPQ
• Endotoxin: <1.0eu g="" purified="" protein="" (lal="">
• Purity: >99% as determined by RT-HPLC
• Storage: Can be stored at +4℃ short term (1-2 weeks). For long term storage, store at -20℃ or -70℃

Gene Information

• Gene Name: PTPRN protein tyrosine phosphatase, receptor type, N [ Homo sapiens ]
• Official Symbol: PTPRN
• Synonyms: PTPRN; protein tyrosine phosphatase, receptor type, N; receptor-type tyrosine-protein phosphatase-like N; IA 2; ICA 512; PTP IA-2; islet cell antigen 2; islet cell antigen 512; islet cell autoantigen 3; protein tyrosine phosphatase-like N; IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; FLJ16131
• Gene ID: 5798
• mRNA Refseq: NM_001199763
• Protein Refseq: NP_001186692
• MIM: 601773
• UniProt ID: Q16849
• Chromosome Location: 2q35-q36.1
• Pathway: Type I diabetes mellitus, organism-specific biosystem; Type I diabetes mellitus, conserved biosystem
• Function: GTPase binding; hydrolase activity; phosphatase activity; protein binding; protein tyrosine phosphatase activity; receptor activity; transmembrane receptor protein tyrosine phosphatase activity