Recombinant Rat Il6r, His-tagged

• Cat.No.: Il6r-9168H
• Product Overview: Recombinant Rat Il6r protein, a DNA sequence encoding the extracellular domain of rat IL6R corresponding to amino acid (1-357) was expressed with a C-terminal polyhistidine tag in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Protein Length: 1-357a.a.
• Description: Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation of various tissues, and is known particularly for its role in the immune response and acute phase reactions. The IL6 receptor is composed of two different subunits, IL6R that binds IL6 with low affinity, and ubiquitously expressed Glycoprotein 130 (gp130) which acts as a common signal-transducing receptor and binds the IL-6·IL-6R complex with high affinity. The IL6R, also known as CD126, is a type I transmembrane cytokine receptor and lacks a tyrosine/kinase domain within the cytoplasmic region, unlike other growth factor receptors. The soluble form of IL6R arises from proteolytic cleavage of membrane-bound IL6Rα, and acts agonistically by making the IL6 ligand accessible to the signal transducer gp130. Dysregulated production of IL6 and IL6R are implicated in the pathogenesis of several inflammatory diseases and malignancies such as multiple myeloma, rheumatoid arthritis, or osteoporosis, and it has been reported that a humanized anti-IL6R monoclonal antibody is a promising agent applicable to the therapeutic approach for IL6 driven diseases.
• Form: Lyophilized. 25 mM Tris-HCl, pH7.4, 300 mM NaCl, 1 mM DTT, 5%Trehalose
• Molecular Mass: The soluble form of recombinant rat IL6R consists of 357 amino acids and has a predicted molecular mass of 40 kDa. In SDS-PAGE under reducing conditions, it migrates with an apparent molecular mass of 60-65 kDa due to glycosylation.
• AA Sequence: MLAVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNATIHWVYSGSQSREWTTTGN TLVLRAVQVNDTGHYLCFLDDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAFCEWHPSSTPSPTTKAVMFAKKIN TTNGKSDFQVPCQYSQQLKSFSCEVEILEGDKVYHIVSLCVANSVGSRSSHNVVFQSLKMVQPDPPANLVVSAIP GRPRWLKVSWQDPESWDPSYYLLQFELRYRPVWSKTFTVWPLQVAQHQCVIHDALRGVKHVVQVRGKEEFDIGQW SKWSPEVTGTPWLAEPRTTPAGIPGNPTQVSVEDYDNHEDQYGSSTEATSVLAPVQG
• Purity: >90% as determined by SDS-PAGE
• Storage: Store it at +4℃ for short term. For long term storage, store it at -20℃ ～ -70℃
• Reconstitution: It is recommended to reconstitute the lyophilized rat CD126 in 0.1ml sterile and pre-cooled ddH2O, which can then be further diluted to other aqueous solutions.

Gene Information

• Gene Name: Il6r interleukin 6 receptor [ Rattus norvegicus ]
• Official Symbol: Il6r
• Synonyms: IL6R; interleukin 6 receptor; interleukin-6 receptor subunit alpha; IL-6RA; IL-6R 1; IL-6R-alpha; IL-6R subunit alpha; IL-6 receptor subunit alpha; interleukin 6 receptor, alpha; IL6R1; Il6ra
• Gene ID: 24499
• mRNA Refseq: NM_017020
• Protein Refseq: NP_058716
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; IL-6 Signaling Pathway, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: ciliary neurotrophic factor binding; ciliary neurotrophic factor binding; contributes_to ciliary neurotrophic factor receptor activity; cytokine receptor activity; enzyme binding; enzyme binding; interleukin-6 binding; interleukin-6 binding; interleukin-6 receptor activity; interleukin-6 receptor activity; contributes_to interleukin-6 receptor activity; interleukin-6 receptor binding; contributes_to interleukin-6 receptor binding; protein homodimerization activity; protein homodimerization activity; receptor activity