Active Recombinant SARS-CoV S Protein, His-tagged

• Cat.No.: S-029S
• Product Overview: Recombinant SARS-CoV spike RBD protein fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: SARS-CoV
• Source: HEK293
• Tag: His
• Description: May down-regulate host tetherin (BST2) by lysosomal degradation, thereby counteracting its antiviral activity.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Human ACE-2.
• Molecular Mass: 24.8 kDa
• AA Sequence: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKL
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -108 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: S spike glycoprotein [ SARS coronavirus Tor2 ]
• Official Symbol: S
• Synonyms: S; spike glycoprotein; E2; spike glycoprotein
• Gene ID: 1489668
• Protein Refseq: NP_828851.1
• UniProt ID: P59594