Active Recombinant Rotavirus VP4 Protein, His-tagged

Cat.No. : VP4-01R
Product Overview : Recombinant Rotavirus VP4 Protein (247-479aa) with a His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rotavirus
Source : E.coli
Tag : His
Protein Length : 80-1388 a.a.
Description : Outer capsid protein VP4: Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. It is subsequently lost, together with VP7, following virus entry into the host cell. Following entry into the host cell, low intracellular or intravesicular Ca2+ concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.
Bio-activity : VP4 an outer capsid proteins, induces neutralizing antibodies and is responsible for Rotavirus serotype specificity.
AA Sequence : AQVSEDIIISKTSLWKEMQYNRDIIIRFKFNNSIIKLGGLGYKWSEISFKAANYQYNYLRDGEQVTAHTTCSVNGVNNFSYNGGLLPTHFSISRYEVIKENSYVYVDYWDDSQAFRNMVYVRSLAANLNSVKCSGGNYNFQMPVGAWPVMSGGAVSLHFAGVTLSTQFTDFVSLNSLRFRFSLTVEEPPFSILRTRVSGLYGLPASNPNSGHEYYEIAGRFSLISLVPSNDDY
Purity : > 90%
Storage : 4 centigrade short term, -20 to -80 centigrade long term.Avoid repeat freeze-thaw cycles.
Storage Buffer : Supplied in Tris/PBS-based buffer, with glycerol.
Gene Name VP4 outer capsid protein [ Human rotavirus B ]
Official Symbol VP4
Synonyms VP4; outer capsid protein; tumor necrosis factor receptor superfamily member 3; lymphotoxin B receptor; lymphotoxin beta receptor (TNFR superfamily, member 3); tumor necrosis factor C receptor; tumor necrosis factor receptor 2-related protein; tumor necrosis factor receptor type III
Gene ID 15957179
Protein Refseq YP_008126845
UniProt ID Q6XD93

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All VP4 Products

Required fields are marked with *

My Review for All VP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon