Active Recombinant Rhesus Macaque SAA1 Protein (104 aa)
Cat.No. : | SAA1-001S |
Product Overview : | Recombinant Rhesus Macaque SAA1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Protein Length : | 104 |
Description : | Serum amyloid A proteins (SAA) represents a family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). The level of apo-SAA, normally 1-5 μg/mL in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL apo-lipoprotein. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg. |
Molecular Mass : | Approximately 11.8 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids. |
AA Sequence : | RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY |
Endotoxin : | Less than 1 EU/μg of rRhSAA1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | SAA1 serum amyloid A1 [ Bos taurus (cattle) ] |
Official Symbol | SAA1 |
Synonyms | SAA1; serum amyloid A1; serum amyloid A1 |
Gene ID | 616035 |
◆ Recombinant Proteins | ||
SAA1-1947H | Recombinant Human SAA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAA1-795H | Recombinant Horse SAA1 Protein (1-110 aa), His-tagged | +Inquiry |
SAA1-4941M | Recombinant Monkey Serum Amyloid A1 | +Inquiry |
SAA1-4540B | Recombinant Bovine SAA1 protein, His-tagged | +Inquiry |
SAA1-2497H | Recombinant Human SAA1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAA1-2080HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
SAA1-2081HCL | Recombinant Human SAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAA1 Products
Required fields are marked with *
My Review for All SAA1 Products
Required fields are marked with *
0
Inquiry Basket