Active Recombinant Rat Vegf164 Protein (165 aa)

• Cat.No.: Vegfa-145V
• Product Overview: Recombinant Rat Vegf164 Protein (165 aa) without tag was expressed in P. pastoris.

Specification

• Species: Rat
• Source: P.pastoris
• Protein Length: 165
• Description: Vascular Endothelial Growth Factor A164 (VEGF-A164), a member of the cysteine knot growth factor, is one of major isoforms of VEGF-As. VEGF-As are endothelial cell-specific mitogens with angiogenic and vascular permeability-inducing properties. During maturation, rat VEGF-A is alternatively spliced to generate rVEGF-A120, rVEGF-A164 and rVEGF-A188 which correspond to hVEGF-A121, hVEGF-A165 and hVEGF-A189 in human, respectively (the numbers designate the amino acid residues). The active form of rVEGF-A164 is either a homodimeric or heterodimeric polypeptides which bind to the transmembrane tyrosine kinases receptors FLT1, FLK1 or KDR or to the non-tyrosine kinase neuropilin receptors NRP1/2.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 4 ng/mL, measured by cell proliferation assay of HUVEC.
• Molecular Mass: 38 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by reducing SDS-PAGE.
• Storage: Lyophilized recombinant rat Vascular Endothelial Growth Factor A164(rrVEGF-A164) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrVEGF-A164 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Vegfa vascular endothelial growth factor A [ Rattus norvegicus ]
• Official Symbol: Vegfa
• Synonyms: VEGFA; vascular endothelial growth factor A; VPF; VEGF-A; vascular permeability factor; Vegf; VEGF164
• Gene ID: 83785
• mRNA Refseq: NM_001110333
• Protein Refseq: NP_001103803
• UniProt ID: P16612