Active Recombinant Rat Tnf Protein (157 aa)

Cat.No. : Tnf-147T
Product Overview : Recombinant Rat Tnf Protein (157 aa) without tag was expressed in P. pastoris.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : P.pastoris
ProteinLength : 157
Description : Tumor Necrosis Factor-Alpha (TNF-Alpha) also known as Cachectin and TNFSF1A, plays a major role in growth regulation, differentiation, inflammation, viral replication, tumorigenesis, and autoimmune diseases; and in viral, bacterial, fungal, and parasitic infections. Besides inducing hemorrhagic necrosis of tumors, TNF has been found to be involved in tumorigenesis, tumor metastasis, viral replication, septic shock, fever, inflammation, and autoimmune diseases including Crohn's disease, and rheumatoid arthritis as well as graft-versus-host disease.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 50 pg/mL, measured in a cytotoxicity assay using mouse L-929 cells in the presence of actinomycin D, corresponding to a specific activity of > 2.0 × 10^7 units/mg.
Molecular Mass : 17.4kDa, observed by reducing SDS-PAGE.
AA Sequence : MLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant rat Tumor Necrosis Factor-Alpha (rrTNF-Alpha) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrTNF-Alpha should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Tnf tumor necrosis factor [ Rattus norvegicus ]
Official Symbol Tnf
Synonyms TNF; tumor necrosis factor; cachectin; tumor necrosis factor alpha; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor ligand superfamily member 2; Tnfa; RATTNF; TNF-alpha; MGC124630;
Gene ID 24835
mRNA Refseq NM_012675
Protein Refseq NP_036807
UniProt ID P16599

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Tnf Products

Required fields are marked with *

My Review for All Tnf Products

Required fields are marked with *

0

Inquiry Basket

cartIcon