Active Recombinant Rat Il1b Protein (152 aa)

• Cat.No.: Il1b-363I
• Product Overview: Recombinant rat Interleukin-1 Beta (rat IL-1 Beta) produced in E. coli is a single non-glycosylated polypeptide chain containing 152 amino acids. A fully biologically active molecule, recombinant rat IL-1 Beta protein has a molecular mass of 17.3kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 152
• Description: Interleukin-1 Beta (IL-1 Beta) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 10 pg/mL, measured by a cell proliferation assay using mouse D10S cells, corresponding to a specific activity of > 1.0 × 10^8 units/mg.
• Molecular Mass: 17.3 kDa, observed by reducing SDS-PAGE.
• AA Sequence: VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant rat Interleukin-1 Beta (IL-1 Beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant rat IL-1 Beta should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Il1b interleukin 1 beta [ Rattus norvegicus ]
• Official Symbol: Il1b
• Synonyms: IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta
• Gene ID: 24494
• mRNA Refseq: NM_031512
• Protein Refseq: NP_113700
• UniProt ID: Q63264