Active Recombinant Rat Il1a Protein

• Cat.No.: Il1a-251I
• Product Overview: Recombinant Rat Il1a Protein without tag was expressed in CHO.

Specification

• Species: Rat
• Source: CHO
• Description: Interleukin-1 alpha (IL-1α), is produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including stimulation of thymocyte proliferation via IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1beta is a secreted cytokine, IL-1alpha is predominantly a cell-associated cytokine.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5 pg/mL, measured in a proliferation assay using D10S cells.
• Molecular Mass: 17~22 kDa, observed by reducing SDS-PAGE.
• AA Sequence: APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Rat Interleukin-1 alpha remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Interleukin-1 alpha should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il1a interleukin 1 alpha [ Rattus norvegicus ]
• Official Symbol: Il1a
• Synonyms: IL1A; interleukin 1 alpha; interleukin-1 alpha; IL-1 alpha
• Gene ID: 24493
• mRNA Refseq: NM_017019
• Protein Refseq: NP_058715
• UniProt ID: P16598