Species : |
Rat |
Source : |
E.coli |
Protein Length : |
73 |
Description : |
Rat GRO-beta/MIP-2/CXCL2 has been found to be expressed by cytokine stimulated rat alveolar macrophages and fibroblasts. Based on its protein and DNA sequences, GRO-beta/MIP-2 is a member of the alpha (CXC) subfamily of chemokines. The protein sequence of rat GRO-beta/MIP-2 shares approximately 88% identity with murine MIP2. Characteristic of ELR containing CXC chemokines, GRO-beta/MIP-2 is known to be a potent chemotactic factor for rat neutrophils in vitro and in vivo. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
Fully biologically active when compared to standard. Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg. |
Molecular Mass : |
7.9 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids. |
AA Sequence : |
VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN |
Endotoxin : |
Less than 1 EU/μg of rRtMIP-2/CXCL2 as determined by LAL method. |
Purity : |
>98% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |