Active Recombinant Rat Cxcl2 Protein (73 aa)

• Cat.No.: Cxcl2-010C
• Product Overview: Recombinant Rat Cxcl2 Protein without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 73
• Description: Rat GRO-beta/MIP-2/CXCL2 has been found to be expressed by cytokine stimulated rat alveolar macrophages and fibroblasts. Based on its protein and DNA sequences, GRO-beta/MIP-2 is a member of the alpha (CXC) subfamily of chemokines. The protein sequence of rat GRO-beta/MIP-2 shares approximately 88% identity with murine MIP2. Characteristic of ELR containing CXC chemokines, GRO-beta/MIP-2 is known to be a potent chemotactic factor for rat neutrophils in vitro and in vivo.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/mL, corresponding to a Specific Activity of ＞1 × 10^5 IU/mg.
• Molecular Mass: 7.9 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids.
• AA Sequence: VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
• Endotoxin: Less than 1 EU/μg of rRtMIP-2/CXCL2 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Cxcl2 chemokine (C-X-C motif) ligand 2 [ Rattus norvegicus ]
• Official Symbol: Cxcl2
• Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; MIP2; CINC-3; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; cytokine-induced neutrophil chemoattractant 3; Mip-2; Scyb2
• Gene ID: 114105
• mRNA Refseq: NM_053647
• Protein Refseq: NP_446099
• UniProt ID: P30348