Active Recombinant Rat Cxcl10 Protein (77 aa)

• Cat.No.: Cxcl10-175C
• Product Overview: Recombinant rat IP-10/CRG-2/CXCL10 produced in HEK 293 cells is a polypeptide chain containing 77 amino acids. A fully biologically active molecule, rr IP-10/CRG-2/CXCL10 has a molecular mass of 8.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Rat
• Source: HEK293
• Protein Length: 77
• Description: C-X-C motif chemokine 10 (CXCL10) also known as interferon gamma-induced protein 10 (IP-10) or small-inducible cytokine B10, is originally identified as an IFN-γ-inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1β, TNF-α, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of the skin.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of rat IP-10/CRG-2/CXCL10 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCXCR3 cells (human Gα15 and rat CXCR3 stably expressed in CHO-K1 cells) is less than 300 ng/mL.
• Molecular Mass: 8.7 kDa, observed by reducing SDS-PAGE.
• AA Sequence: IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 98% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Rat IP-10/CRG-2/CXCL10 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat IP-10/CRG-2/CXCL10 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Cxcl10 chemokine (C-X-C motif) ligand 10 [ Rattus norvegicus ]
• Official Symbol: Cxcl10
• Synonyms: CXCL10; chemokine (C-X-C motif) ligand 10; C-X-C motif chemokine 10; gamma-IP10; protein Mob-1; small-inducible cytokine B10; interferon-inducible protein 10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; small inducible cytokine B subfamily (Cys-X-Cys) member 10; small inducible cytokine B subfamily (Cys-X-Cys), member 10; IP-10; Scyb10
• Gene ID: 245920
• mRNA Refseq: NM_139089
• Protein Refseq: NP_620789
• UniProt ID: Q6GTC7