Active Recombinant Rat CSF2 Protein

• Cat.No.: CSF2-48R
• Product Overview: Recombinant Rat CSF2 Protein without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Description: Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) is hematopoietic factor produced by entothelial cells, monocytes, fibroblasts and T cells in response to a number of inflammatory mediators. GM-CSF is able to stimulate the production of neutrophilic granulocytes, macrophages, and mixed granulocyte-macrophage colonies from bone marrow cells. GM-CSF can also stimulate some functional activities in mature granulocytes and macrophages. Human and mouse GM-CSF show no cross-reactivity.
• Bio-activity: FDC-P1 cell proliferation, ≤20 pg/mL
• Molecular Mass: Monomer, 14.7 kDa (128 aa)
• AA Sequence: MAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20ºC
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 20 mM sodium bicarbonate, pH 8.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Rattus norvegicus (Norway rat) ]
• Official Symbol: CSF2
• Synonyms: CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; colony-stimulating factor; Gmcsf; Gm-csf
• Gene ID: 116630
• mRNA Refseq: NM_053852
• Protein Refseq: NP_446304
• UniProt ID: P48750