Active Recombinant Rat Ccl2 Protein (125 aa)

• Cat.No.: Ccl2-172C
• Product Overview: Recombinant rat MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 125 amino acids. A fully biologically active molecule, rrMCP-1/CCL2 has a molecular mass of 10-15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Rat
• Source: HEK293
• Protein Length: 125
• Description: Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of rat MCP-1/CCL2 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCCR2 cells (human Gα15 and rat CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/mL.
• Molecular Mass: 10~15 kDa, observed by reducing SDS-PAGE.
• AA Sequence: QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 98% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Rat MCP-1/CCL2 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat MCP-1/CCL2 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Ccl2 chemokine (C-C motif) ligand 2 [ Rattus norvegicus ]
• Official Symbol: Ccl2
• Synonyms: CCL2; chemokine (C-C motif) ligand 2; C-C motif chemokine 2; small inducible gene JE; small inducible cytokine A2; small-inducible cytokine A2; monocyte chemotactic protein 1; monocyte chemoattractant protein 1; monocyte chemoattractant protein-1; immediate-early serum-responsive JE protein; immediate-early serum-responsive protein JE; MCP-1; Scya2; Sigje
• Gene ID: 24770
• mRNA Refseq: NM_031530
• Protein Refseq: NP_113718
• UniProt ID: P14844