Active Recombinant Porcine Trypsin Protein

• Cat.No.: Trypsin-01P
• Product Overview: Recombinant Porcine Trypsin is expressed in E.coli and purified by standard chromatography techniques.

Specification

• Description: Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-α-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid.
• Source: E. coli
• Species: Porcine
• Form: Sterile Filtered lyophilized powder.
• Bio-activity: 4500 USP units/mg protein.
• AA Sequence: VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
• Unit Definition: One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0 ml at pH7.6 and 25 centigrade, with BAEE as a substrate (1 cm light path).
• Applications: Trypsin digestion: the suggested ratio is 1:50 to 1:1000 (w/w).
• Notes: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
• Stability: Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18 centigrade.
  For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  Please prevent freeze-thaw cycles.
• Preservative: The Porcine Trypsin was lyophilized with mannitol as preservative.
• Reconstitution: It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100 μg/mL, which can then be further diluted to other aqueous solutions.
• Shipping: Shipped at Room temperature.

Gene Information

• Official Symbol: Trypsin
• Synonyms: Trypsin