Active Recombinant Porcine Trypsin Protein
Cat.No. : | Trypsin-01P |
Product Overview : | Recombinant Porcine Trypsin is expressed in E.coli and purified by standard chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Description : | Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-α-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid. |
Form : | Sterile Filtered lyophilized powder. |
Bio-activity : | 4500 USP units/mg protein. |
AA Sequence : | VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN |
Unit Definition : | One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0 ml at pH7.6 and 25 centigrade, with BAEE as a substrate (1 cm light path). |
Applications : | Trypsin digestion: the suggested ratio is 1:50 to 1:1000 (w/w). |
Notes : | Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
Stability : | Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Preservative : | The Porcine Trypsin was lyophilized with mannitol as preservative. |
Reconstitution : | It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100 μg/mL, which can then be further diluted to other aqueous solutions. |
Shipping : | Shipped at Room temperature. |
Official Symbol | Trypsin |
Synonyms | Trypsin |
◆ Recombinant Proteins | ||
Trypsin-853P | Active Recombinant Porcine Trypsin | +Inquiry |
Trypsin-5502P | Recombinant Pig Trypsin protein, His-tagged | +Inquiry |
Trypsin-95P | Recombinant Pig Trypsin Protein, Proteomics Grade | +Inquiry |
Trypsin-852B | Active Recombinant Bovine Trypsin | +Inquiry |
trypsin-4204D | Recombinant Dog trypsin protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
Trypsin-265H | Native Human Trypsin | +Inquiry |
Trypsin-51P | Active Native Porcine Trypsin | +Inquiry |
Trypsin-251H | Active Native Human Trypsin | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Trypsin Products
Required fields are marked with *
My Review for All Trypsin Products
Required fields are marked with *
0
Inquiry Basket