Active Recombinant Porcine Trypsin Protein

Cat.No. : Trypsin-01P
Product Overview : Recombinant Porcine Trypsin is expressed in E.coli and purified by standard chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Description : Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-α-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid.
Form : Sterile Filtered lyophilized powder.
Bio-activity : 4500 USP units/mg protein.
AA Sequence : VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Unit Definition : One USP unit of trypsin activity will produce a Delta A253 of 0.003 per minute in a reaction volume of 3.0 ml at pH7.6 and 25 centigrade, with BAEE as a substrate (1 cm light path).
Applications : Trypsin digestion: the suggested ratio is 1:50 to 1:1000 (w/w).
Notes : Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Stability : Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18 centigrade.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Preservative : The Porcine Trypsin was lyophilized with mannitol as preservative.
Reconstitution : It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100 μg/mL, which can then be further diluted to other aqueous solutions.
Shipping : Shipped at Room temperature.
Official Symbol Trypsin
Synonyms Trypsin

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Trypsin Products

Required fields are marked with *

My Review for All Trypsin Products

Required fields are marked with *

0

Inquiry Basket

cartIcon