Active Recombinant Porcine IL2 Protein

Cat.No. : IL2-158P
Product Overview : Recombinant Porcine IL2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Interleukin 2 (IL-2) is an immunomodulatory cytokine that is produced by lymphocytes. IL-2 signals through the IL-2R receptor to induce activated T cell proliferation and promote T cell differentiation. IL-2 also stimulates the proliferation and differentiation of B cells, natural killer cells, monocytes, and macrophages.
Source : E. coli
Species : Porcine
Bio-activity : CTLL-2 cell proliferation, ED50≤1 ng/mL
Molecular Mass : Monomer, 15.3 kDa (with 135 amino acids)
AA Sequence : MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT
Endotoxin : ≤1 EUs/μg, Kinetic LAL (50% confidence)
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL2 interleukin 2 [ Sus scrofa (pig) ]
Official Symbol IL2
Synonyms IL2; interleukin 2; interleukin-2; T-cell growth factor; IL-2; TCGF; POIL2;
Gene ID 396868
mRNA Refseq NM_213861
Protein Refseq NP_999026
UniProt ID P26891

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL2 Products

Required fields are marked with *

My Review for All IL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon