Active Recombinant Mouse Vegfa Protein

Cat.No. : Vegfa-7368M
Product Overview : Recombinant Murine Vascular Endothelial Growth Factor120 without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site.
Form : Lyophilized
Bio-activity : Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1-10 ng/mL.
Molecular Mass : 28.2 kDa
AA Sequence : APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Endotoxin : < 0.1 ng/μg of VEGF120
Purity : > 95 % by SDS-PAGE and Silver staining
Stability : Shelf life: one year from despatch.
Storage : The lyophilized protein is stable at 2-8 centigrade for up to 1 week or at -20 centigrade for longer.
Following reconstitution store (in aliquots) at -20 centigrade.
Avoid repeated freezing and thawing.
Storage Buffer : 50 mM Acetic Acid
Reconstitution : The lyophilized VEGF120 is soluble in water and most aqueous buffers. The lyophilized VEGF120 should be reconstituted in 50 mM acetic acid or medium containing at least 0.1 % human or bovine serum albumin to a concentration not lower than 50 μg/mL.
Gene Name Vegfa vascular endothelial growth factor A [ Mus musculus (house mouse) ]
Official Symbol Vegfa
Synonyms Vegfa; vascular endothelial growth factor A; V; Veg; Vpf; Vegf; VEGF12; VEGF16; VEGF18; vascular endothelial growth factor A; vascular permeability factor
Gene ID 22339
mRNA Refseq NM_001025250
Protein Refseq NP_001020421
UniProt ID Q00731

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Vegfa Products

Required fields are marked with *

My Review for All Vegfa Products

Required fields are marked with *

0

Inquiry Basket

cartIcon