Active Recombinant Mouse Tnfsf4 Protein, His-tagged

• Cat.No.: Tnfsf4-01M
• Product Overview: Recombinant mouse OX40 Ligand (51-198aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Description: Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
• Source: Insect cell
• Species: Mouse
• Tag: His
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Human TNFRSF4.
• Molecular Mass: 17.7kDa (157aa)
• Protein length: 51-198aa
• AA Sequence: SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol.

Gene Information

• Gene Name: Tnfsf4 tumor necrosis factor (ligand) superfamily, member 4 [ Mus musculus (house mouse) ]
• Official Symbol: Tnfsf4
• Synonyms: Tnfsf4; tumor necrosis factor (ligand) superfamily, member 4; Ath; OX4; gp3; Ath-; Ath1; Txgp; gp34; Ath-1; CD134; Ox40l; TXGP1; CD134L; OX-40L; Tnlg2b; Txgp1l; tumor necrosis factor ligand superfamily member 4; OX40 ligand; atherosclerosis 1; tax-transcriptionally activated glycoprotein 1 ligand; tumor necrosis factor ligand 2b
• Gene ID: 22164
• mRNA Refseq: NM_009452
• Protein Refseq: NP_033478
• UniProt ID: P43488