Active Recombinant Mouse Tnfsf11 Protein
Cat.No. : | Tnfsf11-6551M |
Product Overview : | Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 11 (Tnfsf11) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts. During osteoclast differentiation, in a TMEM64 and ATP2A2-dependent manner induces activation of CREB1 and mitochondrial ROS generation necessary for proper osteoclast generation. |
Bio-activity : | Determined by its dose-dependent ability to induce reporter gene in HT-29 NF-kB Luc reporter cells. |
Molecular Mass : | 19.4 kDa |
AA Sequence : | PAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Tnfsf11 tumor necrosis factor (ligand) superfamily, member 11 [ Mus musculus (house mouse) ] |
Official Symbol | Tnfsf11 |
Synonyms | TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; OPG ligand; osteoprotegerin ligand; osteoclast differentiation factor; receptor activator of NF-kappaB ligand; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor-related activation-induced cytokine; ODF; OPG; OPGL; RANKL; Ly109l; Trance |
Gene ID | 21943 |
mRNA Refseq | NM_011613 |
Protein Refseq | NP_035743 |
UniProt ID | O35235 |
◆ Recombinant Proteins | ||
TNFSF11-2650H | Recombinant Human TNFSF11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFSF11-3253H | Active Recombinant Human TNFSF11 protein(Gly 63-Asp 244), rFc-tagged | +Inquiry |
TNFSF11-59R | Recombinant Rat TNFSF11 (RANKL) | +Inquiry |
TNFSF11-322HAF555 | Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Tnfsf11-7836R | Recombinant Rat Tnfsf11 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF11-1093HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
TNFSF11-998HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
TNFSF11-001CCL | Recombinant Cynomolgus TNFSF11 cell lysate | +Inquiry |
TNFSF11-1586MCL | Recombinant Mouse TNFSF11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfsf11 Products
Required fields are marked with *
My Review for All Tnfsf11 Products
Required fields are marked with *