Active Recombinant Mouse Prdx1 Protein, His-tagged
Cat.No. : | Prdx1-7295M |
Product Overview : | Recombinant Mouse Prdx1 Protein with a His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Tag : | His |
Description : | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. |
Form : | Liquid |
Bio-activity : | Specific activity is >2,500 pmol/min/μg. Enzymatic activity is defined as the amount of hydroperoxide that 1 μg of enzyme can reduce at 25 centigrade for minute. |
Molecular Mass : | 23.2 kDa |
AA Sequence : | MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQKLEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Prdx1 peroxiredoxin 1 [ Mus musculus (house mouse) ] |
Official Symbol | Prdx1 |
Synonyms | Prdx1; peroxiredoxin 1; P; pr; MSP; OSF; PAG; OSF3; Paga; PrxI; TDX2; TPxA; Tdpx; prx1; MSP23; NkefA; OSF-3; PrdxI; Tdpx2; peroxiredoxin-1; Trx dependent peroxide reductase 2; macrophage 23 Kd stress protein; macrophage 23 kDa stress protein; macrophage 23kDa stress protein; macrophase stress protein 22kDa; macrophase stress protein 23 kd; osteoblast-specific factor 3; proliferation-associated gene A; thioredoxin peroxidase 2; thioredoxin-dependent peroxide reductase 2; thioredoxin-dependent peroxiredoxin 1; EC 1.11.1.24 |
Gene ID | 18477 |
mRNA Refseq | NM_011034 |
Protein Refseq | NP_035164 |
UniProt ID | P35700 |
◆ Recombinant Proteins | ||
PRDX1-2679C | Recombinant Cricetulus Griseus PRDX1 Protein (2-199 aa), His-tagged | +Inquiry |
Prdx1-5101M | Recombinant Mouse Prdx1 Protein, Myc/DDK-tagged | +Inquiry |
Prdx1-60M | Active Recombinant Full Length Mouse Prdx1 Protein, His-tagged | +Inquiry |
PRDX1-423H | Recombinant Full Length Human Peroxiredoxin 1, His-tagged | +Inquiry |
PRDX1-504H | Recombinant Human PRDX1 Protein (Met1-Lys199), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX1-2883HCL | Recombinant Human PRDX1 293 Cell Lysate | +Inquiry |
PRDX1-2882HCL | Recombinant Human PRDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Prdx1 Products
Required fields are marked with *
My Review for All Prdx1 Products
Required fields are marked with *
0
Inquiry Basket