Active Recombinant Mouse Prdx1 Protein, His-tagged

• Cat.No.: Prdx1-7295M
• Product Overview: Recombinant Mouse Prdx1 Protein with a His tag.

Specification

• Species: Mouse
• Tag: His
• Description: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation.
• Form: Liquid
• Bio-activity: Specific activity is >2,500 pmol/min/μg. Enzymatic activity is defined as the amount of hydroperoxide that 1 μg of enzyme can reduce at 25 centigrade for minute.
• Molecular Mass: 23.2 kDa
• AA Sequence: MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQKLEHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Prdx1 peroxiredoxin 1 [ Mus musculus (house mouse) ]
• Official Symbol: Prdx1
• Synonyms: Prdx1; peroxiredoxin 1; P; pr; MSP; OSF; PAG; OSF3; Paga; PrxI; TDX2; TPxA; Tdpx; prx1; MSP23; NkefA; OSF-3; PrdxI; Tdpx2; peroxiredoxin-1; Trx dependent peroxide reductase 2; macrophage 23 Kd stress protein; macrophage 23 kDa stress protein; macrophage 23kDa stress protein; macrophase stress protein 22kDa; macrophase stress protein 23 kd; osteoblast-specific factor 3; proliferation-associated gene A; thioredoxin peroxidase 2; thioredoxin-dependent peroxide reductase 2; thioredoxin-dependent peroxiredoxin 1; EC 1.11.1.24
• Gene ID: 18477
• mRNA Refseq: NM_011034
• Protein Refseq: NP_035164
• UniProt ID: P35700