Active Recombinant Mouse Kitl Protein
Cat.No. : | Kitl-7281M |
Product Overview : | Recombinant Mouse Kitl Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 26-189 |
Description : | Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. |
Form : | Liquid |
Bio-activity : | Murine LIF is fully biologically active when compared to standards. The ED50 as determined by the M1 cell differentiation assay is = 0.05 ng/mL, corresponding to a specific activity of = 2 × 10^7 units/mg. |
Molecular Mass : | 18 kDa |
AA Sequence : | MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by bradford assay) |
Storage Buffer : | Phosphate buffer saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Kitl kit ligand [ Mus musculus (house mouse) ] |
Official Symbol | Kitl |
Synonyms | Kitl; kit ligand; S; Gb; SC; SF; Sl; bl; Clo; Con; Kit; Mgf; SCF; SLF; Ste; blz; Kitlg; contrasted; kit ligand; C-kit ligand; Steel factor; cloud gray; grizzle-belly; hematopoietic growth factor KL; mast cell growth factor; stem cell factor; EC 3.2.1.31 |
Gene ID | 17311 |
mRNA Refseq | NM_001347156 |
Protein Refseq | NP_001334085 |
UniProt ID | P20826 |
◆ Recombinant Proteins | ||
KITLG-325H | Active Recombinant Human KITLG Protein, His & Avi-tagged, Biotinylated | +Inquiry |
KITLG-3748C | Recombinant Chicken KITLG | +Inquiry |
KITLG-961H | Active Recombinant Human KITLG Protein | +Inquiry |
Kitl-208M | Active Recombinant Mouse Kitl | +Inquiry |
Kitl-7281M | Active Recombinant Mouse Kitl Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kitlg Products
Required fields are marked with *
My Review for All Kitlg Products
Required fields are marked with *
0
Inquiry Basket