Active Recombinant Mouse Il7 Protein
Cat.No. : | Il7-117M |
Product Overview : | Purified recombinant protein of Mouse interleukin 7 (Il7) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | The protein encoded by this gene is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms. |
Bio-activity : | The ED50 as determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is< 0.2 ng/ml, corresponding to a specific activity of≥ 5 x 10^6 units/mg. |
Molecular Mass : | 15 kDa |
AA Sequence : | MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il7 interleukin 7 [ Mus musculus (house mouse) ] |
Official Symbol | Il7 |
Synonyms | Il7; interleukin 7; Il-7; hlb368; A630026I06Rik; interleukin-7 |
Gene ID | 16196 |
mRNA Refseq | NM_008371 |
Protein Refseq | NP_032397 |
UniProt ID | P10168 |
◆ Recombinant Proteins | ||
Il7-1684R | Recombinant Rat Il7 Protein, His-tagged | +Inquiry |
IL7-233H | Recombinant Human IL7 | +Inquiry |
IL7-55H | Recombinant Human IL7 Protein, His-tagged | +Inquiry |
IL7-2256R | Recombinant Rhesus monkey IL7 Protein, His-tagged | +Inquiry |
IL7-22H | Recombinant Human IL7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il7 Products
Required fields are marked with *
My Review for All Il7 Products
Required fields are marked with *
0
Inquiry Basket