Active Recombinant Mouse Il7 Protein

• Cat.No.: Il7-117M
• Product Overview: Purified recombinant protein of Mouse interleukin 7 (Il7) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: The protein encoded by this gene is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms.
• Bio-activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is< 0.2 ng/ml, corresponding to a specific activity of≥ 5 x 10^6 units/mg.
• Molecular Mass: 15 kDa
• AA Sequence: MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il7 interleukin 7 [ Mus musculus (house mouse) ]
• Official Symbol: Il7
• Synonyms: Il7; interleukin 7; Il-7; hlb368; A630026I06Rik; interleukin-7
• Gene ID: 16196
• mRNA Refseq: NM_008371
• Protein Refseq: NP_032397
• UniProt ID: P10168