Active Recombinant Mouse Il3 Protein

• Cat.No.: Il3-107M
• Product Overview: Purified recombinant protein of Mouse interleukin 3 (Il3) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
• Bio-activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg.
• Molecular Mass: 15.1 kDa
• AA Sequence: MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il3 interleukin 3 [ Mus musculus (house mouse) ]
• Official Symbol: Il3
• Synonyms: Il3; interleukin 3; BPA; PSF; HCGF; Il-3; MCGF; Csfmu; interleukin-3; P-cell-stimulating factor; hematopoietic growth factor; mast cell growth factor; multipotential colony-stimulating factor
• Gene ID: 16187
• mRNA Refseq: NM_010556
• Protein Refseq: NP_034686
• UniProt ID: P01586