Active Recombinant Mouse Il21r Protein, hIgG/His-tagged

• Cat.No.: Il21r-02M
• Product Overview: Recombinant mouse IL21R (20-237aa), fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Description: Enables cytokine receptor activity. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in lung; mandible; and orbito-sphenoid. Human ortholog(s) of this gene implicated in B-cell lymphoma (multiple); Crohn's disease; autoimmune disease (multiple); human immunodeficiency virus infectious disease; and immunodeficiency 56. Orthologous to human IL21R (interleukin 21 receptor).
• Source: HEK293
• Species: Mouse
• Tag: His&Fc
• Form: Liquid
• Bio-activity: Measured by its ability to inhibit IFN-g secretion using NK-92 human natural killer cells. The ED50 range ≤ 4 μg/mL with mouse IL-2.
• Molecular Mass: 52 kDa (457aa)
• Protein length: 20-237aa
• AA Sequence: CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDPH
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Il21r interleukin 21 receptor [ Mus musculus (house mouse) ]
• Official Symbol: Il21r
• Synonyms: Il21r; interleukin 21 receptor; NILR; interleukin-21 receptor; IL-21 receptor; IL-21R; LR-beta; NR8; lymphocyte receptor beta; novel cytokine receptor 8; novel interleukin receptor
• Gene ID: 60504
• mRNA Refseq: NM_021887
• Protein Refseq: NP_068687.1
• UniProt ID: Q9JHX3