Active Recombinant Mouse Il21 Protein
Cat.No. : | Il21-153M |
Product Overview : | Purified recombinant protein of Mouse interleukin 21 (Il21) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation. |
Bio-activity : | Measured by its ability to increase proliferation in mouse splenocytes induced by anti-hCD40 mAb. The expected ED50 is 15-20 ng/ml. |
Molecular Mass : | 15 kDa |
AA Sequence : | MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il21 interleukin 21 [ Mus musculus (house mouse) ] |
Official Symbol | Il21 |
Synonyms | Il21; interleukin 21; IL-21; interleukin-21 |
Gene ID | 60505 |
mRNA Refseq | NM_021782 |
Protein Refseq | NP_068554 |
UniProt ID | Q9ES17 |
◆ Recombinant Proteins | ||
il21-4335S | Recombinant Salmon il21 Protein | +Inquiry |
Il21-3512M | Recombinant Mouse Il21 Protein, Myc/DDK-tagged | +Inquiry |
Il21-187M | Active Recombinant Mouse interleukin 21 Protein, Tag Free | +Inquiry |
IL21-652H | Recombinant Human IL21 protein, MYC/DDK-tagged | +Inquiry |
IL21-371H | Recombinant Human IL21 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il21 Products
Required fields are marked with *
My Review for All Il21 Products
Required fields are marked with *
0
Inquiry Basket