Active Recombinant Mouse Il21 Protein

• Cat.No.: Il21-153M
• Product Overview: Purified recombinant protein of Mouse interleukin 21 (Il21) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG1 and IgG3 in B-cells. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
• Bio-activity: Measured by its ability to increase proliferation in mouse splenocytes induced by anti-hCD40 mAb. The expected ED50 is 15-20 ng/ml.
• Molecular Mass: 15 kDa
• AA Sequence: MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il21 interleukin 21 [ Mus musculus (house mouse) ]
• Official Symbol: Il21
• Synonyms: Il21; interleukin 21; IL-21; interleukin-21
• Gene ID: 60505
• mRNA Refseq: NM_021782
• Protein Refseq: NP_068554
• UniProt ID: Q9ES17