Active Recombinant Mouse IL17A Protein

• Cat.No.: IL17A-139M
• Product Overview: Recombinant Mouse IL17A Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Interleukin 17A (IL-17A), also known as CTLA-8, is a member of the IL-17 family of proteins.
• Bio-activity: Production of IL-6 by mouse 3T3 cells, ≤5 ng/mL
• AA Sequence: MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution:
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature

Gene Information

• Gene Name: Il17a interleukin 17A [ Mus musculus (house mouse) ]
• Official Symbol: IL17A
• Synonyms: IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Il17; Ctla8; IL-17; Ctla-8; IL-17A
• Gene ID: 16171
• mRNA Refseq: NM_010552
• Protein Refseq: NP_034682
• UniProt ID: Q62386