Active Recombinant Mouse Il13 Protein, His-Tagged

• Cat.No.: Il13-01M
• Product Overview: Recombinant mouse Il13 Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Interleukin 13 (IL-13) is a protein that in humans is encoded by the IL13 gene. IL-13 was first cloned in 1993 and is located on chromosome 5q31 with a length of 1.4kb. It has a mass of 13 kDa and folds into 4 alpha helical bundles. The secondary structural features of IL-13 are similar to that of Interleukin 4 (IL-4); however it only has 25% sequence homology to IL-4 and is capable of IL-4 independent signaling. IL-13 is a cytokine secreted by T helper type 2 (Th2) cells, CD4 cells, Natural killer T cell, Mast cell, Basophil cells, Eosinophil cells and Nuocyte cells. Interleukin-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. It is a mediator of allergic inflammation and different diseases including asthma.
• Form: Lyophilized powder
• AA Sequence: MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFI
  TKLLSYTKQLFRHGPF with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <4 ng/mL. The specific activity of recombinant mouse IL-13 is > 2.5 x 10^5 IU/mg.
• Purity: >95% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il12 interleukin 12 [ Mus musculus (house mouse) ]
• Official Symbol: Il13
• Synonyms: IL-13
• Gene ID: 16163
• mRNA Refseq: NM_008355.3
• Protein Refseq: NP_032381.1
• UniProt ID: P20109